SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367234|ref|YP_001659507.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367234|ref|YP_001659507.1|
Domain Number 1 Region: 6-232
Classification Level Classification E-value
Superfamily Ribosomal protein S2 1.28e-94
Family Ribosomal protein S2 0.000000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166367234|ref|YP_001659507.1|
Sequence length 265
Comment 30S ribosomal protein S2 [Microcystis aeruginosa NIES-843]
Sequence
MPVVSLAELLESGVHFGHQTRRWNPKMSQYIYTARNGVHIIDLVQTAQLIEEAYEFVRGE
ADRGKRFLFIGTKRQAAAIIKQEALRSGSHFVNQRWLGGMLTNWETIRGRVERLKELEEL
ENSGALDKRPKKEASVLRRELGKLEKYLGGIKTMRRLPDLVVVVDQRREYNAIQECQKLG
IPIISLLDTNCDPDLVDVPIPANDDAIRSVKLILGKISDAIIEGRRGGQAAVEEYEEDYD
NETEYEEEGDYSQYAAEFASGDDDN
Download sequence
Identical sequences A0A139GJY5 A0A2H6KZ50 B0JTL2 I4I483
gi|166367234|ref|YP_001659507.1| WP_004162676.1.10452 WP_004162676.1.4043 WP_004162676.1.50331 WP_004162676.1.52201 449447.MAE_44930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]