SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367490|ref|YP_001659763.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367490|ref|YP_001659763.1|
Domain Number 1 Region: 1-203
Classification Level Classification E-value
Superfamily Heme oxygenase-like 6.68e-58
Family TENA/THI-4 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166367490|ref|YP_001659763.1|
Sequence length 208
Comment transcriptional activator [Microcystis aeruginosa NIES-843]
Sequence
MLSQQLWHSHQDLVQACLEHPFVRGIATGELKRDCFAFYVGQDAFFLESFARAYSIAAAK
APDWQGFTSFHRLAAGVLKELELHENYALQWGVDLRKVQPANATRRYRDFLLATAWMGDI
GAIAVAMSPCMRLYAYLGQQLALEPIPENPYQAWIDSYSGDEFEALASQLEELADKYTLM
TENISLSYRYALSCELDFFSAAYSRGKS
Download sequence
Identical sequences B0JUX3 I4HVA1
WP_004162521.1.4043 WP_004162521.1.50331 gi|166367490|ref|YP_001659763.1| 449447.MAE_47490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]