SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166367529|ref|YP_001659802.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367529|ref|YP_001659802.1|
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily RbcX-like 3.01e-43
Family RbcX-like 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166367529|ref|YP_001659802.1|
Sequence length 132
Comment Rubisco chaperonin [Microcystis aeruginosa NIES-843]
Sequence
MYPKKVVQDTAKVLQSYLTYQAVRTIIDQLSETNPTLAIWLSHYTSSHSIQDGEAYIAGL
MTENKELVLRIMTVREHLAEQVLEFLPEMVKTGIINDNTEHRRQLLERLTRTAISQPETS
ELNLDVDDLPNP
Download sequence
Identical sequences A0A0A1VPS5 A0A0F6U639 A0A0K1S2Q9 A0A1E4QH21 A0A1V4BNW9 A0A1X9LD64 A0A2H6BVS8 A0A2H6KZ22 A8YF92 B0JVL7 B3EYR8 B3EYS0 B3EYS2 B3EYS4 I4F8D8 I4G8D8 I4GYU6 I4I3X3 I4IET5 I4ITI0 L7EAG8 L8NZX8 O88134 Q798B8 Q798B9 Q798C2 Q798C3 Q798C6 Q798C9 S3JCM1
449447.MAE_47880 gi|166367529|ref|YP_001659802.1| WP_002732424.1.10452 WP_002732424.1.13945 WP_002732424.1.15998 WP_002732424.1.20667 WP_002732424.1.23084 WP_002732424.1.39664 WP_002732424.1.4043 WP_002732424.1.42333 WP_002732424.1.43950 WP_002732424.1.43975 WP_002732424.1.5315 WP_002732424.1.62741 WP_002732424.1.6707 WP_002732424.1.7764 WP_002732424.1.79847 WP_002732424.1.86711 WP_002732424.1.88161 WP_002732424.1.98808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]