SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166367675|ref|YP_001659948.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367675|ref|YP_001659948.1|
Domain Number 1 Region: 447-861
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 3.14e-119
Family Iron-containing alcohol dehydrogenase 0.00000141
Further Details:      
 
Domain Number 2 Region: 6-452
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-83
Family ALDH-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166367675|ref|YP_001659948.1|
Sequence length 888
Comment bifunctional acetaldehyde-CoA/alcohol dehydrogenase [Microcystis aeruginosa NIES-843]
Sequence
MTVTNRQELEELIQQVKKAQQQFANYSQEQVDLIFKKAALAANNARIPLAKMAVQETGMG
VIEDKVIKNHFASEIIYNKYKHSKTCGIIEEDKSFGLQKIAEPVGILAGIVPTTNPTATA
IFKALIALKTRNGIIFSPHPRAKDCTIAAAKIVLEAAVKAGAPAGIIGWIDQPSVELSQA
LMQHPSINLILATGGPGMVKAAYSSGRPSLGVGAGNTPALIDETAHIKMAVSSIILSKTF
DNGMICASEQSVIVVDSIYEEVRQEFIDRGAYLLSPEEREKVAEILLKDGHINPDIVGQP
VEKLAAIAEISVPEDTRLLIGEVENIGLEEPFSYEKLSPILAMYRAKDFEDGVKKAEKLV
LFAGRGHTAVLYTAPSNREHIKRFEDNVETARVLINTPSSQGAIGDIYNFRLDPSLTLGC
GTWGGNSISENVEPTHLLNIKTVAERRENMLWFRVPPKVYFKYGALPVAIRELAGKKRAF
IVTDKPLFDLGVTAPLEEVLEEIGITINIFYDVEPDPSLETVERGLNVINTFNPDVIIAI
GGGSPMDAAKIMWLLYEHPEIEFESLAMRFMDIRKRVYELPPLGEKALMVCIPTTSGTGS
EVTPFAVVTDRRNNIKYPLADYALTPSMAIVDPELVLNMPKKLTAYGGIDALTHALEAYV
SVLASEYTNALAQDAIRLLFKYLPSSYHNGAKDPKAREKVHYAATMAGMAFANGFLGICH
SMAHQLGAIFHIPHGLANALMISHVILYNATDAPFKQATFSQYKYPNVKWRYARIAHSLG
LGGESETESVERLVLAIECLKREIGIPASIKEVIPETEAEFMAKLDHLAEQAFDDQCTGA
NPRYPLIEDLKTLLIQAYHGNLPLEVAVNGHGDVSLADLKLDPQPLSL
Download sequence
Identical sequences B0JW13
gi|166367675|ref|YP_001659948.1| 449447.MAE_49340 WP_012267401.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]