SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166367930|ref|YP_001660203.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367930|ref|YP_001660203.1|
Domain Number 1 Region: 60-172
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.16e-35
Family Pentapeptide repeats 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166367930|ref|YP_001660203.1|
Sequence length 179
Comment hypothetical protein MAE_51890 [Microcystis aeruginosa NIES-843]
Sequence
MKPKLLTAFCLLLITVFSCFHPAIARAVTPTGGVPAKITLVEPAAADNLQKLQETNACVG
CDFNGISLKDLNLSSANLEGANLSQADLERTNLQGANLKGTDLRGADLGKTLLAGADLSK
ANLLGADLEKANLQGANLTNANLQKADLEKANLTNARLDGANLQDADGEGAIGVDPNLF
Download sequence
Identical sequences B0JXX3
WP_012267582.1.4043 gi|166367930|ref|YP_001660203.1| 449447.MAE_51890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]