SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166367965|ref|YP_001660238.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367965|ref|YP_001660238.1|
Domain Number 1 Region: 692-821
Classification Level Classification E-value
Superfamily beta-Roll 1.57e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 541-640
Classification Level Classification E-value
Superfamily CalX-like 2.75e-17
Family CalX-beta domain 0.0049
Further Details:      
 
Domain Number 3 Region: 213-370
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000709
Family Reprolysin-like 0.044
Further Details:      
 
Domain Number 4 Region: 405-502
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000732
Family Collagen-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166367965|ref|YP_001660238.1|
Sequence length 910
Comment hypothetical protein MAE_52240 [Microcystis aeruginosa NIES-843]
Sequence
MKTTQVSSDLSSTDMSSLADFLSFDGAFPITFDLTGSDDLTVSKETSPLGVLNSNPSPSI
VSSEAPTVSASPANDRTAVSNFASNTFTLADSFPRTLISSQPTHDQQDDVSKLFRDGWIG
QDHSPQLFSSLHGGDSKASGPCTCSQCSLPPVDPRRIVPEAETLNKLPLPSLDLTKTFSL
NSLPGANHTIYLDFNGHTTTGTLWNTAFGKSSIVTPTFDLDGSPASFSTTELERIQYIWQ
RVVEDFSPFNVNVTTQEPTLDRLIKSGTTDTAWGVRVAIGGSSYDWFGAGAGGVAYVGSF
NWNSDTPTFVFSTQTLSDEKYTAEAISHEVGHTLGLKHDGRTTPSEAYYLGHGAGETGWA
PIMGAGYYQNLTQWSKGQYLAANNTEDDLAIITTQNGFGYRVDDKGNTLATASTLTVFGT
AVSSSGIIERNTDVDFFSFTTAAGPISLTVTPSNRGPNLDILAELYNASGVLVASSNPAD
FLAASISANVGAGTYYLKVDGVGKGDPLGTGYTDYGSLGQYAITGSIIRGTISIAKTTDG
NEAGSVSSVFTLTRTGDLSSALTVNYTLGGTATPGVDYTGTTPSSVTFAALSPTATITLP
TKDDLLSDPGETITTTITAPVGYTISGPDNATATILDNDGNAANDNLVGTGFADALAGVG
GNDTLSGLGGNDTLDGGADNDTYLFNTDLVLGSDLLIDALGTDTLNFAATTTKTINLNLG
STAAQTVTAGNLTLTLARATAFENVIGGSLNDTILGNSLVNSLTGGAGNDSLTGGLGKDI
LTGSDGLDTLNYNSLGESLLTGFDVIQGYNGTGASLDSINAPAPIAPITLTASKGTASSL
TEAAIQLVLTNAAFAANTAAAFTLDPLANPNYANDTFIALNNGVAGFQAANDAIIQLSGY
KIAVAPVLVI
Download sequence
Identical sequences B0JY08
gi|166367965|ref|YP_001660238.1| 449447.MAE_52240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]