SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166367973|ref|YP_001660246.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367973|ref|YP_001660246.1|
Domain Number 1 Region: 2-212
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.02e-48
Family Phosphoglucomutase, first 3 domains 0.00000164
Further Details:      
 
Domain Number 2 Region: 410-544
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.39e-48
Family Phosphoglucomutase, C-terminal domain 0.0000142
Further Details:      
 
Domain Number 3 Region: 279-415
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.14e-37
Family Phosphoglucomutase, first 3 domains 0.0000153
Further Details:      
 
Domain Number 4 Region: 183-293
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.92e-30
Family Phosphoglucomutase, first 3 domains 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166367973|ref|YP_001660246.1|
Sequence length 544
Comment phosphoglucomutase [Microcystis aeruginosa NIES-843]
Sequence
MTIETVATKPFSDQKPGTSGLRKSVPVFQQPHYLENFIQAIFNTLDGIEGQTLVVGGDGR
YYNRQAIQTILKIAAANGIGRILVGTDGIVSTPAISGLIRENNAFGGIVLSASHNPGGPE
GDFGIKYNITNGGPAPENITDAIYAETKVISSYKILLGADINLDRPSSFKLGTMDVEVID
AVTPYVKMMEKIFDFDRIQALLTSGKFKMCMDSLHAVTGPYAYAIFEQRLGAPKGTVLNG
IPLEDFGGGHPDPNLVYAHDLVEILFGQEAPDFGAASDGDGDRNMILGRNFFVTPSDSLA
VLTANAHLVPGYQNGITGVARSMPTSAAADRVAAKLGIDCYETPTGWKFFGNLLDAGKAT
LCGEESFGTGSNHIREKDGLWAVLFWLNILAVKGESVEEIVRSHWQEFGRNFYSRHDYEE
VALEPAKEMMARLQKLVLDLKGKQFGNYEVEYADDFSYTDPVDGSVSKNQGIRIGFTDGS
RIIYRLSGTGTKGATLRVYLESYEPDASKHDIDTQKALQPLIDLAEEIGQIRQSTGREQP
TVIT
Download sequence
Identical sequences B0JY16 I4HJX4
WP_002796000.1.4043 WP_002796000.1.50331 449447.MAE_52320 gi|166367973|ref|YP_001660246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]