SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368042|ref|YP_001660315.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368042|ref|YP_001660315.1|
Domain Number 1 Region: 90-283
Classification Level Classification E-value
Superfamily Formyltransferase 8.37e-60
Family Formyltransferase 0.00016
Further Details:      
 
Domain Number 2 Region: 5-86
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000004
Family BT0572-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368042|ref|YP_001660315.1|
Sequence length 284
Comment formyltetrahydrofolate deformylase [Microcystis aeruginosa NIES-843]
Sequence
MTGTTATLLISCPDQIGLVAKIANFIYANGGNIIHADQHTDFSAGLFLMRIEWQLEGFNL
PRGMIEPAFAAIAKPLQASWSLHFSDTVPRLAIWVTKQDHCLLDLLWRQHGGEIRAEIPL
IISNHPELHSVANQFGIEFHHIPITAETKIEQEARQLELLREYRIDLVILAKYMQVLTPD
FINFFPNIINIHHSFLPAFAGANPYQRAYDRGVKIIGATAHYITADLDQGPIIEQDVVRV
SHRDTVGDLIRQGKDLERVVLARAVRLHLQNRVLVYANRTVVFA
Download sequence
Identical sequences A0A1V4BLY3 B0JY85 I4FNI4 I4HKH3
WP_002759669.1.24258 WP_002759669.1.4043 WP_002759669.1.50331 WP_002759669.1.79847 gi|166368042|ref|YP_001660315.1| 449447.MAE_53010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]