SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368084|ref|YP_001660357.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368084|ref|YP_001660357.1|
Domain Number 1 Region: 14-410
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 7.72e-134
Family ArgJ-like 0.000000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368084|ref|YP_001660357.1|
Sequence length 413
Comment bifunctional ornithine acetyltransferase/N-acetylglutamate synthase [Microcystis aeruginosa NIES-843]
Sequence
MADWQEIEGGITAPKGFKSAGMAAGLKPSGLPDLALIVSETEAIAAGVFTTSQVRAACVD
YCRQRLQTKASARAILCNAGQANAATGAAGWQDALDSAAALSQVLGIPADAILLASTGVI
GQRIRMDALTAALPTLVGLLSENGGESTARAIMTTDLVPKSIALQTTIEGRPVTIGGIAK
GSGMIHPNMATMLSFITCDAAVSTVLWQNMLSRAANKSFNQITVDGDTSTNDSLIALANG
QSRTTAITEMGRDAQKLEAMLTEVCQYLAKAIARDGEGATCLMEVRVSGAADDQSARQIA
RTIAGSSLVKSAVFGRDPNWGRIAAAAGRAGIVFHQEDLQIKLGDFVMMENGQPLAFDRA
SASNYLKAAASGAYLREDTVLMSICIGNGSGTGTAWGCDLSYDYVKINAEYTT
Download sequence
Identical sequences B0JYC7 I4HKQ6
449447.MAE_53430 WP_002796125.1.4043 WP_002796125.1.50331 gi|166368084|ref|YP_001660357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]