SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368096|ref|YP_001660369.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368096|ref|YP_001660369.1|
Domain Number 1 Region: 12-327
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.57e-55
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 401-508
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.01e-29
Family Pentapeptide repeats 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368096|ref|YP_001660369.1|
Sequence length 528
Comment serine/threonine protein kinase [Microcystis aeruginosa NIES-843]
Sequence
MTYCLNPNCTQPKNAPTALICESCGSKLLLHDRYQTLRILGKGGFGATFVSSDLSLPDKP
LCVVKQLQPPPKDASVFRMAKDLFDREAETLAKLGVHPQIPRLLDYFEDNQEFYLVQEYV
KGHNLHQEVKKRGPFSEAGVKQFLSELLPILKYVHEQRVIHRDIKPANLIRRQTDRKLVL
IDFGAVKNPVNSVMANADSQTALTNFAVGTQGFAPPEQMAMRPVYASDIYAVGATCLYLL
TGKSPKAIEVDINTGELLWEKLVKVSPQFAKVLKTMLEVSVRHRYKSAQEVMDALDMTAY
ADSLAQSLIAAPMVTSQPPRQNSGSMATSSVSVPLKSKFRPKNQNPEASPDNMLGGQMAF
SLFNTNVLNKSKARSSTELTLLKKKPRLDEKALLDAYNNGRRNFAQEELPNLNLAKAKLV
GVNFCQSKLTRANLQGADLSNADLGRANLSQAILKSTNLNNAYLGYADLEKADLRGANLT
GAHLRYANLKDANLCGANLSDAQVTREQIALAKTNWLTVMPNGKRGSW
Download sequence
Identical sequences B0JYD9 I4HKT1
WP_002796134.1.4043 WP_002796134.1.50331 449447.MAE_53550 gi|166368096|ref|YP_001660369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]