SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368108|ref|YP_001660381.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368108|ref|YP_001660381.1|
Domain Number 1 Region: 5-140
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 2.09e-34
Family PurM N-terminal domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 146-307
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 1.15e-28
Family PurM C-terminal domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368108|ref|YP_001660381.1|
Sequence length 322
Comment thiamine monophosphate kinase [Microcystis aeruginosa NIES-843]
Sequence
MNLTVKDLGEQGLLPILQKYCPAEIIGDDGAILCLKDGYSLVVTTDVLVNNVHFSDITTS
PEDVGWRAAAANLSDLAAMGAEPLGITVGLALTPDLAIDWLEGLYRGLSSCLQVYQTAIV
GGDVCRATEINISITALGQVAKNEEIRRFNAKVGDSIVITGYHGLSRAGLELLFHPETGR
NLNSAQKKRLIQAHQRPRPRLDCIPHLQKIVKQFPIAGMDSSDGLADAIMQICRCSGVGA
EIERIPLHPTLKEYVGAEKALEWALYGGEDFELVLCLPPDSARELLEKVGEEGAIIGQIV
PGKEIKLADGRNLSLSSGFQHF
Download sequence
Identical sequences B0JYF1
gi|166368108|ref|YP_001660381.1| WP_012267712.1.4043 449447.MAE_53670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]