SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368111|ref|YP_001660384.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368111|ref|YP_001660384.1|
Domain Number 1 Region: 3-248
Classification Level Classification E-value
Superfamily Hsp33 domain 1.44e-58
Family Hsp33 domain 0.00000495
Further Details:      
 
Domain Number 2 Region: 239-298
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 2.62e-16
Family HSP33 redox switch-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368111|ref|YP_001660384.1|
Sequence length 304
Comment Hsp33-like chaperonin [Microcystis aeruginosa NIES-843]
Sequence
MADKLIRATAADGGIRVVGVITTRLTEEARQRHKLSNVATAALGRTMASALLLASSLKKP
GSRVNIRIKGDGPLGGVLVDAGLDGTVRGYVDYPQVELLPNAQGKLDVGRAVGDKGYVRV
LREEKGEGRNELQESIVEIVSGEVGEDIAYYLDQSEQIPSALQVGVFVGTTTGVTAAGGI
LLQVLSKEASRDEVLVARLESRLRKLTGFTPLLRAGKGLEDIFQELLGDMGLEIFPAVQM
LRFDCDCSFERALGALKFLGVDELKDIIEKDKQAEAICEFCREVYNANERQLIELVESLQ
AESC
Download sequence
Identical sequences B0JYF4 I4HKW4
gi|166368111|ref|YP_001660384.1| 449447.MAE_53700 WP_002796148.1.4043 WP_002796148.1.50331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]