SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368140|ref|YP_001660413.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368140|ref|YP_001660413.1|
Domain Number 1 Region: 89-198
Classification Level Classification E-value
Superfamily Fe,Mn superoxide dismutase (SOD), C-terminal domain 5.63e-46
Family Fe,Mn superoxide dismutase (SOD), C-terminal domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 1-88
Classification Level Classification E-value
Superfamily Fe,Mn superoxide dismutase (SOD), N-terminal domain 6.94e-36
Family Fe,Mn superoxide dismutase (SOD), N-terminal domain 0.0000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368140|ref|YP_001660413.1|
Sequence length 199
Comment superoxide dismutase [Microcystis aeruginosa NIES-843]
Sequence
MAYTLPPLPYDYTALEPCITKSTLEFHHDKHHAAYVNNYNGLVKDTELDALSLEEVIVKV
AGDASKAGVFNNAAQAWNHSFYWDCMKPGGGGAPTGALADKIQADFGSFEKFVEAFKTAG
ATQFGSGWAWLVLDNGTLKVTKTGNADNPLTAGQVPLLTMDVWEHAYYLDYQNRRPDYIS
DFLTKLVNWDFVAANLAAA
Download sequence
Identical sequences A0A139GSB6 A0A1V4BLY1 B0JGF5
gi|166368140|ref|YP_001660413.1| WP_012267735.1.4043 WP_012267735.1.52201 WP_012267735.1.79847 449447.MAE_53990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]