SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368144|ref|YP_001660417.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368144|ref|YP_001660417.1|
Domain Number 1 Region: 183-642
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.39e-116
Family Amylase, catalytic domain 0.00000000481
Further Details:      
 
Domain Number 2 Region: 650-752
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.28e-38
Family alpha-Amylases, C-terminal beta-sheet domain 0.00035
Further Details:      
 
Domain Number 3 Region: 14-118
Classification Level Classification E-value
Superfamily E set domains 8.4e-16
Family E-set domains of sugar-utilizing enzymes 0.026
Further Details:      
 
Domain Number 4 Region: 141-198
Classification Level Classification E-value
Superfamily E set domains 0.00000000504
Family E-set domains of sugar-utilizing enzymes 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368144|ref|YP_001660417.1|
Sequence length 759
Comment glycogen branching protein [Microcystis aeruginosa NIES-843]
Sequence
MSIVVSPEQVHQIVNNLHHDPFEVLGAHPLEEEGKVNKWVVRAYLPKTTAAWVILPSQRQ
EYPMTTAYHPHFFECVIDISELNNYQLRIHEGEQERVIYDSYAFRSAKLSDFDLHLFGEG
NHHRIYEKLGAHLAEIEGIKGVYFAVWAPNARNVSIIGDFNNWDGRDHQMRKRNNMVWEL
FIPEIGVGTKYKYEIKNWEGHIYEKSDPYGFAQEVRPKTASIVANLDSYTWDDSDWMEKR
RHSDPLTQPVSVYELHLGSWLHASSAEPPRLLSGEGEAVPVSEWNTGARFLSYYELAQKL
IPYVKELGYTHIELLPIAEHPFDGSWGYQVTGYFAPTSRYGNPEDFMYFVDQCHQNGLGV
LVDWVPGHFPKDGHGLAFFDGTHLYEHGDPRKGEHKEWGTLIFNYGRNEVRNFLVANALF
WFDKYHIDGIRVDAVASMLYLDYCRKDGEWVANEYGGRENLEAAEFLRQVNHVIFSYFPG
ILSIAEESTAWPMVSWPTYMGGLGFNLKWNMGWMHDMLDYFGMDPWFRQFHQNNVTFSMW
YNHSENYMLALSHDEVVHGKSNMIGKMPGDEWQKFANVRALFSYMFTHPGKKTMFMSMEF
GQWSEWNVWGDLEWGLLQYEPHQQLKRFFSDLNATYKSEPALYTQDFGQDGFEWIDCSDN
SHSVVSFLRWSKNWQEFLVVVCNFTPQPHSHYRVGVPHPGFYQEIFNSDAGKYGGSNMGN
LGGKWSEEWSYHSRPYSIDLCLPPLGVLVLKISPNASGE
Download sequence
Identical sequences B0JGF9
WP_012267738.1.4043 gi|166368144|ref|YP_001660417.1| 449447.MAE_54030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]