SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368149|ref|YP_001660422.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368149|ref|YP_001660422.1|
Domain Number 1 Region: 6-70,105-237
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 0.0000000000811
Family Tubulin, GTPase domain 0.0061
Further Details:      
 
Weak hits

Sequence:  gi|166368149|ref|YP_001660422.1|
Domain Number - Region: 1051-1076
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0293
Family Ribosomal protein L40e 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368149|ref|YP_001660422.1|
Sequence length 1078
Comment hypothetical protein MAE_54080 [Microcystis aeruginosa NIES-843]
Sequence
MPAAVEEKSMVPTVLVGIGGTGNEILSRLRRLIEESYGSLSNFPIVSFLVVDTDKDYKIS
NPEAAGSAFKDNEKHWSRVSGKQVQEMVSDMDRYPWINSWFPPELERNITSLEAGAGQIR
ACGRFALFCNYHEIQRKFLDAVRRVKGQENFMLDRYGIKVNNTAINVFTTGSLNGGTGSG
MLIDIGYCIRNWLRGESSPLSTAIVPTPEAFAGISVGDRVLANGYAALMELNYFSDYRTE
YHQQFSSGLVDEVVSKLPPFDFTYLVGTKNGEGDFKLGQIREMIAQNIFLDMTSDFAPHK
RSIRDNIKGSWAQADPGGRGYPKQFMSFGLSTIEIPIAQIRASLSERLAKDLINWWLNDS
VILPAQMLDLVRGDILKRMRLSEVELIMDLCADKDRSLIAIISQWTNETRQEINQDNWLS
CTKQGVNILGNEQGKILQFINDYLTPRVEEFKRNHLLELSPDERLHGDYLKKIYSNRDEI
IQRGKKSLEMEFYNILEDRNRGVKFAESFIVSVRQIFTDIAEKFRRDQEQVWSQNESKRQ
REYDTALAEINDLKDKIHISKKDKMEEYCEQALTGLEGHLMANIQRKTRGAGVEVINRLL
EHLNQLESRFNRFRQKLIQSRNLFNLQANQQIDSADALLINGIKLFDRQELNGLYQDFIE
QFASGIVGSKNAYDTGMDNLCLPLSEEILKQSSPLWKETRRADENMRLFDITEIADIRQG
DFQQVILNQANQLLQNAPASSQIQQELAACDRLLKIYNNDAEIINNLRIAYQKSRPLIML
NPAVLRGKDAGFTPQLNQNVALIGGRNTSNPAAQKIIPKLREFIANEDDIKPLGDVEKHR
LVFVQEIGGFSLRCLEGMRELRQSYQDWKGEFILAKRAQQMGENRDLPIPVHIQKEPPFW
DVFPEDPSIYQLVVTARALKVLFPEVNRVTNEKTIRYEIKTATGLKKVDIATSWEDAVQV
LEVKACREDKEKIQSQVTAKLQAAATPEKKQALYRTFIEYLQQRSEELTGGKDSTEYKRE
DAIILQLIDNYKLDSGGEIPLSSVTEVVNPALIICGNCGHKNPPSSNFCSKCGAKLVK
Download sequence
Identical sequences B0JGG4
gi|166368149|ref|YP_001660422.1| WP_012267742.1.4043 449447.MAE_54080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]