SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368176|ref|YP_001660449.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368176|ref|YP_001660449.1|
Domain Number 1 Region: 4-286
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.24e-93
Family Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) 0.00000174
Further Details:      
 
Domain Number 2 Region: 290-507
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-41
Family Nucleotide and nucleoside kinases 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368176|ref|YP_001660449.1|
Sequence length 516
Comment bifunctional pantoate ligase/cytidylate kinase [Microcystis aeruginosa NIES-843]
Sequence
MNPVQIFTTIPGLRTFLADYRHDHSIALVPTMGALHKGHASLIRRAVTEAEVTVVSIFVN
PLQFAPTEDFSRYPRSLDSDRQLCESLGVAAIFAPSAETLGIGNSEEITAVVPPISLTSG
LCGAFRPGHFQGVATIVTRLFNIIAPTIAYFGEKDAQQLAIIRQLVRDLNLAIEIRACAT
VRETSGLAVSSRNQYLSATEKEKATIIAQSLQLALESFRLGERQREKLLAIVQKNLDRVP
EFRPQYLDLVHPQSLQPIEQIETGGLLAIAGSIGQTRLIDNIILRQRRAVIAIDGPAGAG
KSTVTRLVAEKLGLTYLDTGAMYRAVTWLVVNSGLDLSAEAAIAELLSLAKIAIIPADSP
ENVTIVKINGQDVTLEIRSPAITSQVSRIAAQKAVRQQLVTLQRQLGMSGGIVVEGRDIG
TNVFPEAELKIFLTATPEERARRRLKDLEAQGNGGISLAELTQEIEKRDYLDSNRSLAPL
RKAADAIEVNTDHLSITEVTEKIIALYHLNSGNLGR
Download sequence
Identical sequences B0JGJ1
gi|166368176|ref|YP_001660449.1| 449447.MAE_54350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]