SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368278|ref|YP_001660551.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368278|ref|YP_001660551.1|
Domain Number 1 Region: 249-501
Classification Level Classification E-value
Superfamily HemD-like 1.7e-70
Family HemD-like 0.0073
Further Details:      
 
Domain Number 2 Region: 7-238
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 2.36e-57
Family Tetrapyrrole methylase 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368278|ref|YP_001660551.1|
Sequence length 505
Comment uroporphyrinogen-III C-methyltransferase and uroporphyrinogen-III synthase fusion protein [Microcystis aeruginosa NIES-843]
Sequence
MSGVVYPRGKVYLLGAGIGQSSFLTLQARAILATAEVLLYDALVDSQIFSLVPKTCVLVD
VGKRGGQPGAEQNQINRILVNYCQEGKRVIRLKSGDPGVFGRVYPEMLALKRAGCDFELI
TGISSALAAPLLAGIPLTEKDISRCFAVLSAHDPESLDWSALAKIDTLVLLMAGQSLGQI
IEKLCQNGRNIHDSIAIIRQAGRKDQQIWRGTLENILAQTAGVSLSPSIMVIGQVVDLAI
MSSPPPLGGKTIVITRAAEQTSQFSEILQNQGAEVLEMPALEIRPPDRWQGLDDAIAQLQ
EFDWLILTSANAVNFFFDRLTFWGKDARALATVKIAVVGKKTSQVLHSRGLKADFIPGDF
VADALVNEFPDPIRGQKFLFPRVETGGREVLVKELTAKAGQVTEVAAYYSGCPARMDSQI
WEAFRDEKVDIVTFASSKTVQNFYQLLLQETAELSVNSLLEKVCLASIGPQTSKTCQELF
GRVDIEAREYTLEGLTSALIESSKT
Download sequence
Identical sequences B0JGU3
gi|166368278|ref|YP_001660551.1| 449447.MAE_55370 WP_012267842.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]