SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368333|ref|YP_001660606.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368333|ref|YP_001660606.1|
Domain Number 1 Region: 6-215
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.83e-64
Family "Hypothetical" protein ybl036c 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368333|ref|YP_001660606.1|
Sequence length 219
Comment hypothetical protein MAE_55920 [Microcystis aeruginosa NIES-843]
Sequence
MTIASRIESIRLTLPPSTRLIAVSKQVSSDYIRQAYRAGVRDFAESKLQEAISKQQELKD
LPDIYWHFIGHLQANKARKVLESFDLIHSLDSLKLAQRLDRLAAELEINPQVLLQVKVIP
DPDKFGWDTDELIADIPALVNCQQLKIQGLMTILPQGLSAGEKLAAFEKTSDLAQIIENS
SSLCLPHLSMGMSNDYPLAIKAGATLIRVGTSIFGDRIY
Download sequence
Identical sequences B0JHK2
gi|166368333|ref|YP_001660606.1| 449447.MAE_55920 WP_012267872.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]