SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368451|ref|YP_001660724.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368451|ref|YP_001660724.1|
Domain Number 1 Region: 7-183
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.00000000000000942
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368451|ref|YP_001660724.1|
Sequence length 234
Comment hypothetical protein MAE_57100 [Microcystis aeruginosa NIES-843]
Sequence
MKTNQPYQPLLLRILHGFTGIALIAAMVTAYWTYDTFDGRWLKLPLPEYQEIESIHGTFG
LYTLIIFPVFAIYAFRRGNKRLIQSDSLNKLTQFGKPIWWYSLHRLVNTLTLFALTFALY
SGRMMDSKWLPEGELNHFWYYAHLLSWLIMAVCLILHLLMTAKVGGVPLLLSILKWRFRE
QDSPKLWLSQLRQWGLSLRLAKIFQWLQSLNLYKILEIVVLLAIIAAWIVPKFD
Download sequence
Identical sequences B0JHX0 I4HMS6
gi|166368451|ref|YP_001660724.1| 449447.MAE_57100 WP_002796411.1.4043 WP_002796411.1.50331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]