SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368472|ref|YP_001660745.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368472|ref|YP_001660745.1|
Domain Number 1 Region: 5-179
Classification Level Classification E-value
Superfamily RL5-like 1.48e-77
Family Ribosomal protein L5 0.000000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368472|ref|YP_001660745.1|
Sequence length 179
Comment 50S ribosomal protein L5 [Microcystis aeruginosa NIES-843]
Sequence
MSQKLKTTYQETIVPKLKEQFGYTNIHQVPKVIKITVNRGLGEASQNAKALESSKAELST
ITGQQPVVTRAKKAIAGFKIREGMPVGVMVTLRGDRMYAFLDRLINLALPRIRDFRGISG
NSFDGRGNYSLGIREQLIFPEIEYDKIDQIRGMDISIITTAKNDEEGRALLKEMGMPFR
Download sequence
Identical sequences B0JHZ1 I4H7D2
WP_002787866.1.4043 WP_002787866.1.77316 gi|166368472|ref|YP_001660745.1| 449447.MAE_57310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]