SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368621|ref|YP_001660894.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368621|ref|YP_001660894.1|
Domain Number 1 Region: 42-180
Classification Level Classification E-value
Superfamily OmpA-like 0.0000000471
Family OmpA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368621|ref|YP_001660894.1|
Sequence length 185
Comment hypothetical protein MAE_58800 [Microcystis aeruginosa NIES-843]
Sequence
MILSLFLLLALFQSYNLISKLEEANRKLQTATPIVIDEKSGKFKFQSGSAELNPALKTYI
RQRIIPAIETITKDREIDFIQVIGHTDGQGIQKTSNLDKNIESVASRKQSVKMLVPGSNT
DLGLMRALAVVQEIENTGKLKNVKFRAFSAGQLYLPSGNLAAVNRDADASRRRIEIRFIP
PGRKQ
Download sequence
Identical sequences B0JIZ4
gi|166368621|ref|YP_001660894.1| 449447.MAE_58800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]