SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368645|ref|YP_001660918.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368645|ref|YP_001660918.1|
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily CheY-like 1.71e-38
Family CheY-related 0.0006
Further Details:      
 
Weak hits

Sequence:  gi|166368645|ref|YP_001660918.1|
Domain Number - Region: 168-377
Classification Level Classification E-value
Superfamily PP2C-like 0.000785
Family PP2C-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368645|ref|YP_001660918.1|
Sequence length 378
Comment two-component response regulator [Microcystis aeruginosa NIES-843]
Sequence
MVRILVIDDDGVIQTFLSRALQKEYEVFVASDGEEGLKQAGQIKPAMIICDWMMPGIDGL
EVCRQIKLNPQLSTTFFILLTSLGSVGDRVKGLDAGADDFLCKPIEINELRARVRAGMRL
HQLSHDLRAQKQLLEMELAEAAEYVRSLLPEPFISPKLAIDFRFLPSRRLGGDGFDYYWL
DNDHLVLYLLDVAGHGLRAALPSLSVINLLRSRGLSQVNYYQPNQVLQGLNQVYQISPRN
DKYFTIWYGIYDQKQQQLTYASAGHPPAVLLTQKPFGQMIETRLKAPGFPIGMFPEAEYI
NQVQSLNFSSSLYLFSDGIYEIDCADGRMWGLENFIQSLRNYHCNSAKNLDNFIEKIQAL
QFDGNFRDDLSIMQVDFR
Download sequence
Identical sequences B0JJ18
gi|166368645|ref|YP_001660918.1| WP_012268092.1.4043 449447.MAE_59040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]