SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368730|ref|YP_001661003.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368730|ref|YP_001661003.1|
Domain Number 1 Region: 35-498
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 2.22e-159
Family Type II DNA topoisomerase 0.0000000014
Further Details:      
 
Domain Number 2 Region: 647-909
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.07e-45
Family GyrA/ParC C-terminal domain-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368730|ref|YP_001661003.1|
Sequence length 914
Comment DNA gyrase subunit A [Microcystis aeruginosa NIES-843]
Sequence
MAKQLDFLASGQIIPTALHQEMERSYLEYAMSVIVGRALPDVRDGLKPVHRRILYAMHEL
GLTPDRPFRKCARVVGDVLGKYHPHGDQSVYEALVRMVQDFSSRYPLLSGHGNFGSIDND
PPAAMRYTETRLAGIGDQAVLGGISEAIVNFSSNFDNSQQEPVVLPAQLPILILNGCSGI
AVGMATNIPPHNLGEVVEGLIALIDNPDLSEEKLVEIIPGPDFPTGGEILDDTGIREAYR
TGRGIIPVRGVAKTETIIIEGKRRRERTAIVVTELPFQVNKAAWIEKIAELVNLGKLEGI
ADIRDESNREGIRVVIELKRESQPQQVLAALYQQTALQTNFGAIILALVDNQPRQLSLKQ
VLQEFLRFRETTLTRQYGDELQQASDRLHLVEGLLLALQNIDRVVDILKNAPDGTTAKYR
FQAELGISDAQADSILAMPLRRLTGLERQKLETEATELQAKIQQLETLLHNRQEFLKSLK
KELRSLKKKFADSRRTKIPTGKSGNRKQETGDRRQETGDRRQETAGKKQDSAVKKQETVP
MKKFSPPETKEVSLPTPHTPHPTPHTPHPTPHTPHPTPHTPHPTPSFKAEVKKQENKVKK
KPESENPPSLSLFTPQEPPENAILLLDAEDKISWTTEEERAPDRGLIIYQQAIEKRENFL
VILDNAKAYPIATREVPPKDNQPVLISSLLTKTAQKDSEAVLNQFFLTEPQKNQELLLLS
QQGRIKRLPIDELEGVGSRGLSLMKLKEDDRLYGAIFTHEGLDLAIATSSGRVLRYPVRE
ELLPMMSKSAQGLAILRLRYGEHLAGCVSLPHRENLLLISGLGYGKRLAIENLRLSQLGD
LGSPALQFVNKQDSLAAMVAAREGSIVLLSTNQNRKLPLEVETVTVTGKDGTGSQLVKLN
PAEKIIKAQLLHHL
Download sequence
Identical sequences B0JJA3
gi|166368730|ref|YP_001661003.1| WP_012268159.1.4043 449447.MAE_59890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]