SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368837|ref|YP_001661110.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368837|ref|YP_001661110.1|
Domain Number 1 Region: 374-695
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 1.03e-96
Family Phosphotransacetylase 0.000000291
Further Details:      
 
Domain Number 2 Region: 211-330
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 1.51e-25
Family DRTGG domain 0.0056
Further Details:      
 
Domain Number 3 Region: 1-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.03e-25
Family Nitrogenase iron protein-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368837|ref|YP_001661110.1|
Sequence length 698
Comment phosphate acetyltransferase [Microcystis aeruginosa NIES-843]
Sequence
MTNSLYISTTATGSGKALVALGIIDLILRKTNKVAFFQPIVLDCSQGHRDEDIDLILNYF
KLEQTYEEAFGLCYDEVKDLLVQQKFDEIIERIIKKFKNLEKKYDFILCEGSDYLQENSA
FEFELNTEIAKNLGHPILILGNAHNRSIEDALSPILISCDTYQDKGCTVIGIIINQAEEE
KIGELRKTLTKIFPPQEYALGVIPHNAKLSSPRVAEIAQQLQAKVLYGQQRLDSLASNFL
VVAMQMQNALERIKEDSLIITPWDRGDVIIGMLQAHQSANYPQLAGIVLTAGHNLNPSIA
RLIEGLPDPLPILSVTTDTYTTAERIHDVRTTLTSTDYDKINLSLQLFHSNINLDRLEAQ
IHTLRTQGITPKMFTYNLVQQAKAQKRHIVLAEGTEPRILQAATVLIEQDIVDLTLLGQP
DEIAMVIKKHGITLDLDRLQIIDPVASPHFESYVQTLYEARKAKGMNLDMARDYAQDVSY
FGTLMVYQGDADGMVSGAVHTTQHTIRPALQIIKTKPDCAIVSSVFFMCLEDRVLVYGDC
AVNPDPSAEELAEIALSSAETAQKFGIEPRIALLSYSSGQSGQGEDVEKVRQATKIAREK
RPDLKLEGPIQYDAAVDREVAAQKMPGSEVAGQATVFIFPDLNTGNNTYKAVQRETKALA
IGPILQGLKKPVNDLSRGCTVPDIINTVVITAIQSQSF
Download sequence
Identical sequences B0JK64
449447.MAE_60960 gi|166368837|ref|YP_001661110.1| WP_012268247.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]