SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368906|ref|YP_001661179.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368906|ref|YP_001661179.1|
Domain Number 1 Region: 66-212
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.57e-16
Family FtsH protease domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368906|ref|YP_001661179.1|
Sequence length 224
Comment hypothetical protein MAE_61650 [Microcystis aeruginosa NIES-843]
Sequence
MEQTALNLIAITVFSITLSVFVTPLLSISPFVPALATFSLLGLVTVDTLTFNNRGVTLLL
DALSPSKHRQRVIYHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFDLADLEQ
KVKNFTDFPAFLERISTVWMAGIAAETLVYGKAAGGESDRFYLQSALKLAGVSENNYAQK
ERWSLLQAKTLLEKQQTAYQALVIAMEKRASVEECCRVISESLV
Download sequence
Identical sequences A0A139GM57 B0JKD3
449447.MAE_61650 WP_012268290.1.4043 WP_012268290.1.52201 gi|166368906|ref|YP_001661179.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]