SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368939|ref|YP_001661212.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368939|ref|YP_001661212.1|
Domain Number 1 Region: 294-467
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.67e-71
Family Transhydrogenase domain III (dIII) 0.0000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368939|ref|YP_001661212.1|
Sequence length 469
Comment pyridine nucleotide transhydrogenase subunit beta [Microcystis aeruginosa NIES-843]
Sequence
MNNALITGIELSYLLAAILFIIGLKQLSSPATARQGNFLAAIGMLIAIIATLINQEILSY
GLIAVALVIGSIIGLVSAQKVPMTAMPQMVGIFNGLGGAASALIAIGEYWRLLQSGENIA
FDSILIAILGILIGGVTFTGSVLAFAKLQELISGAPVTFPFQQPFNILLLLTFLGGSVYL
FFDPTSIDVFLTLVALSLIFGALFVLPIGGGDMPVVISLLNSFSGLAASVVGFILMNSML
IIAGALVGASGIILTQIMCKAMNRSLASVLFGAFGTGASAGGEASATSSLDKSVHAIDSE
EGAMMLGYARSVVIVPGYGMAVAQAQHAVRELAEQLEKNGVEVKYAIHPVAGRMPGHMNV
LLAEANVPYPQLYDMDDINPEFERVDVALIIGANDVVNPAARHDKASPIYGMPILDVDKA
QHTIVIKRSMRSGFAGVENELFYNPKTFMLFGSAQDVVAQLVSQVKDLS
Download sequence
Identical sequences A0A0K1RZG3 B0JL21 I4FY64 I4HT73
WP_002757688.1.24258 WP_002757688.1.4043 WP_002757688.1.43975 WP_002757688.1.50331 gi|166368939|ref|YP_001661212.1| 449447.MAE_61980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]