SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166368993|ref|YP_001661266.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368993|ref|YP_001661266.1|
Domain Number 1 Region: 4-195,343-571
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.95e-132
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000402
Further Details:      
 
Domain Number 2 Region: 599-856
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 8.78e-71
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000305
Further Details:      
 
Domain Number 3 Region: 194-344
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.83e-62
Family ValRS/IleRS/LeuRS editing domain 0.0000169
Further Details:      
 
Domain Number 4 Region: 841-905
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000000000000889
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368993|ref|YP_001661266.1|
Sequence length 906
Comment valyl-tRNA synthetase [Microcystis aeruginosa NIES-843]
Sequence
MTSELSKQYDPKITETKWQQYWENQEIFTANPEKGGETYCIVIPPPNVTGSLHMGHAFES
SLIDTLVRYKRMTGKNTLWLPGTDHASIAVQAILDRQLKAEKTDRYQLGREKFLERAWQW
KEESGSTIVNQLRRLGVSVDWTRERFTMDEGLSHAVRTAFIKLYEDGLIYRGQYLVNWCP
ESRSAVSDLEVENKDIEGNLWYFRYPLSDGSGYLQVATTRPETMLGDTGVAVNPQDPRYR
HLIGKTVTLPIMGREIPIIADELVDPEFGTGCVKVTPAHDPKDFEMGKRHNLAFINIMNL
DGSLNENAGIFVGQDRFVARKNVVKKLDEDGFLVKIEAYRHSVPYSDRGKVPVEPLLSTQ
WFVKIEPLATKALTCLDQENSPRFVPERWTKVYRDWLVKLKDWCISRQLWWGHQIPAWYI
ISETNNEITNHTPFVVAQDETSALAKAKQEYGEDIIIQQDPDVLDTWFSSGLWPFSTMGW
PEKTLDLDTYYPTTTLVTGFDIIFFWVARMTMMAGYFTGQMPFKDVYIHGLVRDENGKKM
SKSANNGIDPLILIDKYGTDALRYTLIREVAGAGQDISLQYNRKTDESESVEAARNFANK
IWNASRFVMMNLEGKTPEELGEPVLENLELADRWILSRYHQTVQKTRDYLENYGMGEAAK
GLYEFIWRDFCDWYIELVKTRLWKDKESVSCATARQTLAFILAGTLKLLHPFMPHITEEI
WHHLTQENQQVLALETYPIADSSLIDLDLENTFELLIESIRVLRNLRAEAGIKPGATITA
ILQTENSQELAILQRGQVYLKDLAKIENFILTAKLTEEVNQAIAGVVATVEILIPLSGLV
DISVLAGKLAKNLAKVEGEIKSLSDRLNKPSFVEKAPEALIQKTKQALAEAEKQAQILQE
RLKRLH
Download sequence
Identical sequences B0JL75
WP_012268355.1.4043 449447.MAE_62520 gi|166368993|ref|YP_001661266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]