SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166364512|ref|YP_001656785.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166364512|ref|YP_001656785.1|
Domain Number - Region: 320-349
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0126
Family Rubredoxin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166364512|ref|YP_001656785.1|
Sequence length 395
Comment transposase [Microcystis aeruginosa NIES-843]
Sequence
MEKAYSFRFYPTPEQESLLRRTLGCVRLVYNKALHERTQAWYEKQERVGYAETSSMLTEW
KKQEELDFLNEVSCVPLQQGLRHLQTAFTNFFAGRTKYPNFKKKHQGGSAEFTKSAFKFK
DKQIYLAKCTEPLPIRWSRQIPESCEPSTVTVRLHPSGRWHISIRFDDPTIKPLPPTDKA
IGIDLGISSLVITSDGDKVSNPKHFKKHYQRLRKAQKNLSRKQKDSKNREKAKIKVAKIH
AQITDSRKDHLHKLTTQLVRENKTIVVENLAVKNMVKNPKLSQAISDVSWGEITRQLAYK
CRWYGRNYIEIDRWFPSSKRCSNCGYIAEKMPLNVREWDCPDCGTHHDRDINASKNILAA
GLAVSVCRATIRPEQSKSVKAGAKNPSGQKQKPKS
Download sequence
Identical sequences B0JWB3
WP_012265088.1.4043 gi|166364512|ref|YP_001656785.1| 449447.MAE_17710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]