SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470171197|ref|YP_007552083.1| from Azoarcus sp. KH32C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470171197|ref|YP_007552083.1|
Domain Number 1 Region: 213-345
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 8.11e-35
Family Cell-division protein ZipA, C-terminal domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470171197|ref|YP_007552083.1|
Sequence length 363
Comment ZipA-like protein [Azoarcus sp. KH32C]
Sequence
MDSELQIGLAALGVAAVVSIVGYNKWQERKHRREAELAFKSEHRDVLLEPNEGGASADER
LEPSVVRGERSGHAAVRDPGLRKATPRPPEQVDSRVDCIIRIESIEPLEAPRLWAAQSEQ
LMGISKPVRWYGFDDAQNVWRELNAHSAGAYHWFCAAMQMVDRRGPISESDLMHFSGGVQ
RVAEAFFAVPAEVPSSGETLRNAAELDRFCAGVDVQIGINIVSSGQPFAGTKIRALAESN
GLVIGNDGAFHACDEDGNTLFTLSNMEANIFAADTMRNIATHGMTLLIDVPRVPNGVFAF
ERMMRQASQMADALQGVVVDDNRSPLGPEAANMIRNQIQHFQAQMASGSMAAGGQLAMRL
FSD
Download sequence
Identical sequences H0PTY9
WP_015436412.1.10474 gi|470171197|ref|YP_007552083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]