SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470172064|ref|YP_007552950.1| from Azoarcus sp. KH32C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470172064|ref|YP_007552950.1|
Domain Number 1 Region: 198-333
Classification Level Classification E-value
Superfamily CBS-domain pair 5.05e-29
Family CBS-domain pair 0.0041
Further Details:      
 
Domain Number 2 Region: 344-424
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.5e-22
Family CorC/HlyC domain-like 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470172064|ref|YP_007552950.1|
Sequence length 443
Comment CBS domain-containing protein [Azoarcus sp. KH32C]
Sequence
MEIILLVALILVNGVFAMSEIALVTAKRARLARLAEDGDPAAAVAMKLGEEPTRFLSTIQ
IGITSIGILNGIVGEAALADPLSGWLQQLGLAQRPSEITSTVLAVVAITYISIVVGELVP
KRIGQINPEGIARLVARPMNALAIGSRPFVRLLMWSTSMLLTLLGKRDEAAPGVTEEEIH
ALLEEGSEAGVIEKSEHEMVRNVFRLDERQIASLMVPRADVVWLDIHRPLDENLARMAES
QHSRFPVCRGGLDDILGIISSKQLFNQTLKGGKPDLTQQLEPAIYVPESLTGMELLEQFR
ASSTHMVFVIDEYGEIQGVVTLQDVLEAVTGEFQPHSLEEAWAVQREDGSWLLDGMIPVP
ELKDRLELKTVPEEEKGRYHTLSGLVMWLLGRLPHTGDIATWEDWRLEVVDLDGKRIDKV
LASRMPESVQTESDNPPAPEAEA
Download sequence
Identical sequences H0Q4D5
WP_015437276.1.10474 gi|470172064|ref|YP_007552950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]