SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170780885|ref|YP_001709217.1| from Clavibacter michiganensis subsp. sepedonicus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170780885|ref|YP_001709217.1|
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.61e-20
Family PadR-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170780885|ref|YP_001709217.1|
Sequence length 138
Comment PadR family transcriptional regulator [Clavibacter michiganensis subsp. sepedonicus]
Sequence
MDTTQLLKGALDTAVLAVVQHDDGYGYDIVRRLRDAGLGDVGDASVYGTLRRLYAAGALS
SYVVPSEGGPHRKYYAINPEGRELLAGQRATWAAFATAMSGLLGEPAPAPTHRTRKAGGA
GEGPVPASVNVRTIGEKP
Download sequence
Identical sequences B0RCG2
gi|170780885|ref|YP_001709217.1| 31964.CMS_0441 WP_012297894.1.12855 WP_012297894.1.13751 WP_012297894.1.33835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]