SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170782569|ref|YP_001710902.1| from Clavibacter michiganensis subsp. sepedonicus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170782569|ref|YP_001710902.1|
Domain Number 1 Region: 11-117
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.77e-19
Family Penicillinase repressor 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170782569|ref|YP_001710902.1|
Sequence length 123
Comment hypothetical protein CMS_2226 [Clavibacter michiganensis subsp. sepedonicus]
Sequence
MSIGRQRPRGELEAAIMDALWDADEPLTAKDVVARIPDPRPALTTVLTVLERLGQKGLVT
RSDEARALTFAPARSRTDHAASLMSGALAATKDREAALLRFAGTLDGDDLTALRRALGGD
DRA
Download sequence
Identical sequences A0A067LGF0 A0A225CHQ2 A5CT44 B0RG27
gi|170782569|ref|YP_001710902.1| 31964.CMS_2226 443906.CMM_2199 gi|148273383|ref|YP_001222944.1| WP_012038889.1.12855 WP_012038889.1.13751 WP_012038889.1.33835 WP_012038889.1.36461 WP_012038889.1.56944 WP_012038889.1.75151 WP_012038889.1.80587 WP_012038889.1.8140 WP_012038889.1.84123 WP_012038889.1.88496 WP_012038889.1.97849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]