SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170782795|ref|YP_001711129.1| from Clavibacter michiganensis subsp. sepedonicus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170782795|ref|YP_001711129.1|
Domain Number 1 Region: 11-162
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.48e-31
Family MarR-like transcriptional regulators 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170782795|ref|YP_001711129.1|
Sequence length 167
Comment MarR family transcriptional regulator [Clavibacter michiganensis subsp. sepedonicus]
Sequence
MPSRDEVDRIVDAWRRERPDLDFSPLEVLSRVGRLSRLLERARRSAFQESELESWEFDVL
SALRRAGDPYQLSPKALLQQTLVSSGTMTNRIDRLVARGLVERRTDPHDGRGILVVMSDA
GRTRVDTAITRLVAEEAELLETLPAADRDVLAGLLRQLILDLDDDGA
Download sequence
Identical sequences A0A1Y3FFP7 A5CTC1 B0RHJ1
gi|148273460|ref|YP_001223021.1| 31964.CMS_2472 443906.CMM_2276 gi|170782795|ref|YP_001711129.1| WP_012038966.1.100120 WP_012038966.1.11755 WP_012038966.1.12855 WP_012038966.1.13751 WP_012038966.1.31775 WP_012038966.1.33835 WP_012038966.1.36461 WP_012038966.1.56944 WP_012038966.1.64112 WP_012038966.1.75151 WP_012038966.1.80587 WP_012038966.1.8140 WP_012038966.1.84123 WP_012038966.1.88496 WP_012038966.1.97611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]