SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170782962|ref|YP_001711296.1| from Clavibacter michiganensis subsp. sepedonicus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170782962|ref|YP_001711296.1|
Domain Number 1 Region: 8-149
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.93e-34
Family MarR-like transcriptional regulators 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170782962|ref|YP_001711296.1|
Sequence length 156
Comment MarR family transcriptional regulator [Clavibacter michiganensis subsp. sepedonicus]
Sequence
MAHEGATRTDPLALESQLCFAAVLAARSVVALYRPILEPLGLTHPQYLVMLALWERDGRS
ISDLGGALALEPATVTPLLKRLQSAGLLERARSAEDERVVRVTLTDAGRALRQQAEQVPA
TVAERTGMTPTELGRIRDDLHAFLARIDAAPDPADA
Download sequence
Identical sequences B0RIU1
WP_012299900.1.12855 WP_012299900.1.13751 WP_012299900.1.33835 gi|170782962|ref|YP_001711296.1| 31964.CMS_2651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]