SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170726654|ref|YP_001760680.1| from Shewanella woodyi ATCC 51908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170726654|ref|YP_001760680.1|
Domain Number 1 Region: 30-520
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 4.97e-182
Family Type II DNA topoisomerase 0.000000000000807
Further Details:      
 
Domain Number 2 Region: 532-864
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.7e-106
Family GyrA/ParC C-terminal domain-like 0.00000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170726654|ref|YP_001760680.1|
Sequence length 905
Comment DNA gyrase subunit A [Shewanella woodyi ATCC 51908]
Sequence
MTDLASSITPINIEDELKNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMSELKNDWN
KPYKKSARVVGDVIGKYHPHGDTAVYDTIVRLAQPFSMRYTLIDGQGNFGSVDGDAAAAM
RYTEIRMDKVAHQLLADLEKETVDYVPNYDGTEFIPAVLPTRIPTLLVNGSSGIAVGMAT
NIPPHNLNEVVSGCLALIENPDLTINELMEYIPGPDFPTAGIINGRKGIIDAYHTGRGRA
VMRAKAEVEIEDNGRERIIVHEIPYQVNKARLIEKIAELVKDKKIEGISGLRDESDKDGM
RIVVEIKRGEVGEVVLNNLYAQTQMQSSFGINMVALTNGQPKLFNLKEMLECFILHRREV
VTRRTVFELRKARERAHILESLAIALANIDPIIALIKASPTPAEAKVKLVAEGWELGNVQ
SMLEKAGDDAARPEWLEPEYGIRDGRYYLTEQQAQAILDLRLHKLTGLEHEKILKEYEEL
LEIIAALLYILRSSVRLMEVITEELQEVLENFGDERRTVINANEVDMSLEDLINEEDVVV
TLSHLGYAKYQALTDYQAQRRGGKGKAATKVKDEDFVEKLLVANTHDTILCFSDFGKMYW
LKVYQLPLASRTARGRPIVNILPLSEGERITAILPVREYAEDKYIIMATSHGTVKKTALT
AYSNPRANGIIAVNLKDGDQLIGVDITDGSNDIMLFSNEGKVVRFNEKARNSETGEVKLD
PETGEEMIALRAMGRTATGVRGIKLEDGQQVVSLIVPKGEGDILTVTENGFGKRTDLAEY
PAKSRGTKGVVSIKVSERNGAVVGAVQVGENDEIMLISNKGTLVRTPATGVSSIGRNTQG
VTIIRTAEDEKVVGLQRIDEIQEPAPELDEEGNPIIPAVADEAVEATPEGEAPNADDAPE
AEPAE
Download sequence
Identical sequences B1KF44
392500.Swoo_2306 WP_012324927.1.29706 WP_012324927.1.77901 gi|170726654|ref|YP_001760680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]