SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170727295|ref|YP_001761321.1| from Shewanella woodyi ATCC 51908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170727295|ref|YP_001761321.1|
Domain Number 1 Region: 129-442
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.94e-66
Family Carboxypeptidase T 0.028
Further Details:      
 
Domain Number 2 Region: 632-743
Classification Level Classification E-value
Superfamily PKD domain 1.1e-18
Family PKD domain 0.0016
Further Details:      
 
Domain Number 3 Region: 573-655
Classification Level Classification E-value
Superfamily PKD domain 0.000000144
Family PKD domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170727295|ref|YP_001761321.1|
Sequence length 773
Comment peptidase M14 carboxypeptidase A [Shewanella woodyi ATCC 51908]
Sequence
MAEITMKTAESIARLTKGITLSRLTKSLIISGLIFSSLAQSQAQAIDDSQQTYKVTFPDE
QTFLKANISLHNEKIKTDPTQRAIWVPLSSDELSRLKPFATSMAKVDDPASLYPQKIASQ
SNLLSGIPGYSCYPTVEETQTDIEQLVSQNPNFATIEDIGDSWQKQAGNGGYDLNLLKLT
NSQVTGDKPKLFIHAAMHAREYATSPLVLQFAKDLLSERDTDADSQWLLDRHEIHLLLHM
NPDGRKKAETGLSWRKNANQNYCGSNPNAIGTDLNRNFSWGWNTVEQGSSGNECSNIFRG
PSAGSEPETQAVEAYVRALFGDHRGPNRTDAAPDTTQGLHIDVHSYSELVLWPWGGTNAL
APNGAAMRTLGRKLARFNGYMPMQSVGLYPTDGTSDNLSYGELGIPHMTFELGTDFFQSC
SSYNDKVLPDNLKALKYAAKIVEAPYLIPSGPDITEISSVGQPLNAIAQNYRVTLKVTAS
DDRFSRRGGTEATQDIAEIALYIDDAPWDGGQATLLTATDGSFDEKTEQGELQLNANDLS
LGQHTLYLKAKDTSGQWGALSAQFIQVIAPQANQAPQANFSFQCDEFTCQFDASSSADPE
GDSLSYAWQLGTGTSREAQPSYQFSSSELTDNKVEVTLTVSDPQGLSHSQTQHLTLSANQ
APKASFTASCTHLVCQIDASASSDPDADTLSYQWQLGDGNSSDKLQLTHSYTQAGTYNIV
LTVSDGKTDNSSEKSVTVTVAPTPEPSENGSSGGAIGLFSLLLLALGIRRQTR
Download sequence
Identical sequences B1KKK9
392500.Swoo_2953 gi|170727295|ref|YP_001761321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]