SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295688222|ref|YP_003591915.1| from Caulobacter segnis ATCC 21756

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295688222|ref|YP_003591915.1|
Domain Number 1 Region: 32-460
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 2.88e-114
Family Class I alpha-1;2-mannosidase, catalytic domain 0.0000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|295688222|ref|YP_003591915.1|
Sequence length 462
Comment mannosyl-oligosaccharide 1,2-alpha-mannosidase [Caulobacter segnis ATCC 21756]
Sequence
MTLARLTRRSALASLGAAGLYAPALAAAPAEDWKALAADVRSEFQWAWRGYVAKAWGKDE
INPVSGTSRSFFIEGHDLGLSLVEALDTLWIMGLDAEFQAGVDWVKTSLDFDVDGEAQVF
ETNIRLVGGLIAAHLACGDPVLLAKAKDLADRLLKAFEASPHGLPWRYVNLKTGAVRDPE
TNLAEIGTYITEFGVLSQLTGEPRYFDIAKRAMKHALDRRSKIGLMAANIDARTGAYTSR
SASIDVYADSFYEYLWDAWELFGDQDCKRWAQECTAAQLAHQAKRYDGRLWFPMVDYETG
AVVNTAQSELAAYYAGLLGQVGHKKEGDDYLASFTEMQATFGVIPESIDVATRQPRRKHT
GLRPEYPDACLNLWLIDRDERYRQLAAIHYRQMKATSRAAFGYTALKDITTKPMTQGDNC
PGYWWSEQMKYYYLLFSDTPRIDYAKLQLSTEANVLRGFRKP
Download sequence
Identical sequences D5VI44
WP_013077964.1.17864 gi|295688222|ref|YP_003591915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]