SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291614046|ref|YP_003524203.1| from Sideroxydans lithotrophicus ES-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291614046|ref|YP_003524203.1|
Domain Number 1 Region: 166-350
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.79e-71
Family Methylesterase CheB, C-terminal domain 0.000000873
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 4.98e-27
Family CheY-related 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291614046|ref|YP_003524203.1|
Sequence length 360
Comment response regulator receiver modulated CheB methylesterase [Sideroxydans lithotrophicus ES-1]
Sequence
MSKIRVMIVDDSAVVRQVLAATLEEDSEIEVSGVASDPVFAIEKMGKSWPDVIVLDVEMP
RMDGITFLKKIMAEHPTPVVICSTLTEKGAETSMQALAAGAVSVITKPKIGLKNYLQDAA
DNLVSTVKAAARSNVRRLQPAAGSVAPKLSADAILSVAAHHAMAQTTETVVAIGTSTGGT
QALEAVLTALPRLSPGIVIVQHMPEKFTEAFANRLNGICQIEVREARNGDRVVPGLALIA
PGGRHMMLKRSGAQYHVDVIEGPLVNRHRPSVDVLFRSTAKCAGSNALGIIMTGMGDDGA
RGLKEMREAGAKTVAQDESTCVVYGMPKEAVRLDAVDRILPLDEIAHAIHPGTLWQRKPA
Download sequence
Identical sequences D5CS80
gi|291614046|ref|YP_003524203.1| WP_013029714.1.26305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]