SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295695990|ref|YP_003589228.1| from Kyrpidia tusciae DSM 2912

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295695990|ref|YP_003589228.1|
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily AF1862-like 3.4e-26
Family Cas Cmr5-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|295695990|ref|YP_003589228.1|
Sequence length 122
Comment Cmr5 family CRISPR-associated protein [Kyrpidia tusciae DSM 2912]
Sequence
MQTRQQQWARDVYEKIDRVEKRSREEQKDYGRICVSFPALLHASGLCQAVAFCQAKGSAP
GREHFIQFLNDLADTVGVDHSWTVAREADLVQYMRLTQRVMQAATWYKRYAEAILKVQPG
ED
Download sequence
Identical sequences D5WY25
gi|295695990|ref|YP_003589228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]