SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295696872|ref|YP_003590110.1| from Kyrpidia tusciae DSM 2912

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295696872|ref|YP_003590110.1|
Domain Number 1 Region: 292-512
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.64e-47
Family ABC transporter ATPase domain-like 0.0000577
Further Details:      
 
Domain Number 2 Region: 20-288
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.62e-22
Family DNA repair protein MutS, domain III 0.0088
Further Details:      
 
Domain Number 3 Region: 706-781
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000000068
Family Smr domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|295696872|ref|YP_003590110.1|
Sequence length 783
Comment MutS2 family protein [Kyrpidia tusciae DSM 2912]
Sequence
MEPRTLRVLEFEKICQILADHAQTDMGKTLALELLPSSDEEEVRSWCRETDEAQAWDRLA
GGVSLQGATDVTESVRRAARGGVLSPEQLYATAELMRVGRRVQRSLEQVQSKARTPQLQA
LASGIPELPALEKAIRESVGEDGAILDGASSELAALRRRKRALADRIRGALDELIRNPNT
QKYLQEPLVTVRDGRYCVPVRVEFKNSFRGIVHDQSASGQTWFIEPAAIVPLGNELRGLE
AQEEREIERILVRLSALVGQEESGLSKAVECLGRLDFALAKSRLAQQMDAVSPHFVGGGK
LRLRRCRHPLIPKERVVPVDVLIGDEYHALIITGPNTGGKTVVLKTAGLLTCMAQAGLFI
PAAEGSELSVFERIFADIGDEQSIEQSLSTFSGHMKHIIEILDQVNERSLVLLDEIGAGT
DPAEGAALAEAILQFFVDRGIRTIATTHYGDLKAFAYTTPGVMNASVEFDPETLRPTYRL
LIGVPGRSNALAVAARLGLGQEILDRARHRLGADDVRVEDMIRQLETARNQAREEADRAR
LDREEASRLRQQWESEVRRWEAEADQRTAQAEERARRIVLQAEREVKDVLEELRRLSRED
RSSLKEHQFTELRQRLDRVKPAFRYGRRVPSSTGEDFGTPGPGDAVEVVSFGQKGTVLEI
QGKEALVQIGALKTRVPVAALRKQKAPAPAAPVSVAVRRGADGVGMELDLRGKTVEEAIP
EIDQYLDRAVLAGLATVHLIHGKGTGALRSGVQTYLRSHPHVRSFRNGGPGEGGLGVTVV
ELK
Download sequence
Identical sequences D5WS14
gi|295696872|ref|YP_003590110.1| WP_013076249.1.77002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]