SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295696875|ref|YP_003590113.1| from Kyrpidia tusciae DSM 2912

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295696875|ref|YP_003590113.1|
Domain Number 1 Region: 217-401
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.02e-66
Family B3/B4 domain of PheRS, PheT 0.00000536
Further Details:      
 
Domain Number 2 Region: 473-695
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.17e-48
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000804
Further Details:      
 
Domain Number 3 Region: 39-201
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.43e-41
Family Myf domain 0.0022
Further Details:      
 
Domain Number 4 Region: 704-801
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.14e-28
Family Anticodon-binding domain of PheRS 0.00015
Further Details:      
 
Domain Number 5 Region: 408-481
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.37e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|295696875|ref|YP_003590113.1|
Sequence length 803
Comment phenylalanyl-tRNA synthetase subunit beta [Kyrpidia tusciae DSM 2912]
Sequence
MKVSYRWLQEWIDLDDLSPEEVAELLTRHGVAVETVRQLNPGLSQVVVGEVLEVRPHPEG
GRLRVCRVDVGRGDPLQIVCGAPNAAPGLRVPTALVGATLPETTIGEAVFRGVASQGMLC
SAKEIGMEARLLPKDQTEGLYVLPPDSPIGKDIVDVLGWDDAVLELDLTPNRSDCLSMVG
VAHELSAILDRPLKFPDWTEGGVAEGPSPVRITLETPLCRRYMGQVIEGARQASSPLWMQ
MRLLAAGIRPIDAIVDATNYVMLELGQPLHAFDFDQVQGGHIRVRAGQPGERLRTLDGVE
RTLDSSMIVIADEARAIGLAGVMGGENSEITASTTRIVLESAWFDPVSVRRTARHLGLRS
EAGLRFEKGVNPEVLPLALARASRFITAHAGGRLVGAPVDKGDLHEDRKKIALRPDKVNE
WLGVKVEPGEMKRIFERLGFSVDRLDMRTWQVEVPSRRRDISREIDLAEEVARLHGYDNI
PATMPEGRVTAAGRTLSQRVRGTIRRFLTDLGFFEVWTYTLQNPSVIGRLNEGRSQEYLA
VLHPMSEERAALRTALLPGLLDAAAYNVRRDQREIAIYEIGRVFHPRGLPLADLPDEREQ
VGALILGRFGPHGIGWEGRPADFYAAKGVAAAVLERLGVQADFVPGVREGLHPGRAAQIQ
VNGRKIGWVGALHPEVEERWEIPKAYYIELDMQDIVKSLPGATTYRPLPRYPGISRDLAL
LVPRERAAREVEAGIRESGGPWLENVELFDVYEGAQVPPGFKSLAFRLSYRAEERTLTDE
EVNDALRRLIDTLRERGVQLRSE
Download sequence
Identical sequences D5WS17
WP_013076252.1.77002 gi|295696875|ref|YP_003590113.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]