SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269839156|ref|YP_003323848.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839156|ref|YP_003323848.1|
Domain Number 1 Region: 163-396
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 3.66e-47
Family Creatinase/aminopeptidase 0.0000897
Further Details:      
 
Weak hits

Sequence:  gi|269839156|ref|YP_003323848.1|
Domain Number - Region: 4-159
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.000235
Family Creatinase/prolidase N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269839156|ref|YP_003323848.1|
Sequence length 403
Comment peptidase M24 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MDSERLARAVDLMTRLRYDALLCRVPEHVFMLTGYLPVMGNSFCLVRLDPGGRLQVLLAV
PEDERDLVPPGAADDVRTFSEETGAQIQDTLQAVRECLQVLLISAALGPRCVIGYEGGQH
PITAPYTQVGFPGKATVDLLRQLRPEAELVDATPLLDRLAAFRTQAELGLMRQATTLAIL
GFDAARSAIVPDATEADVEAQSTAAIIAAGRRDYPDKHIAAHVHVMSGERSARAYRAYNT
TSDRMLQRGDPVLVQMEVCVGGCWAELTRTFFVGEISRQWEVVLGACMRAQREALYKIRP
GASGSKVDAEARKVMRDAGLGEAFRHGLGHGVGLQAINHGAQPRLHPASGDVLHPGMTHN
VEPAAYLDGQGGLRLNDNVLVIPTGCQLLSQGLPRAVDWLVAG
Download sequence
Identical sequences D1CH05
WP_012876057.1.85100 gi|269839156|ref|YP_003323848.1| 525904.Tter_2124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]