SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269839243|ref|YP_003323935.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839243|ref|YP_003323935.1|
Domain Number 1 Region: 110-369
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.11e-72
Family D-glucarate dehydratase-like 0.0004
Further Details:      
 
Domain Number 2 Region: 2-127
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.86e-24
Family Enolase N-terminal domain-like 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269839243|ref|YP_003323935.1|
Sequence length 378
Comment mandelate racemase/muconate lactonizing protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MLIREVRAFGLRGATPRGGWATELRPEDCVHTLVAVVTNEELVGWGSVFTSEDLVRASLA
VLEPLYIGESALEPERVCRKMHEHTFWLGRGGAITHTISGIDIALWDILGKATGQSVGRL
LGGRYRDRVRPYASLLMDEPDLLREHLMELRAQGFRAFKIGWGRFGRQDQQWDESVVKAA
REAIGPESLLMVDAGGSDAFWSQGYKWAIRTAHMLAEYDVYWFEEPLCPDALEEYRLLRQ
QAPILIAAGEVLTRHQSFEPWLRSRALDIVQPDVTKVGGISESRRIAWMAQSYGIRLIPH
GWNTAVGLAADLQLAAALPDTDLVEYKTGSPYIDEITASPWTLDEDGMLPIPNRPGLGID
LDLDAIAKYSGHRDLGLC
Download sequence
Identical sequences D1CH92
525904.Tter_2214 WP_012876144.1.85100 gi|269839243|ref|YP_003323935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]