SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269839307|ref|YP_003323999.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839307|ref|YP_003323999.1|
Domain Number 1 Region: 247-305,369-624,651-778
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.7e-94
Family Amylase, catalytic domain 0.000000224
Further Details:      
 
Domain Number 2 Region: 137-249
Classification Level Classification E-value
Superfamily E set domains 8.68e-20
Family E-set domains of sugar-utilizing enzymes 0.0032
Further Details:      
 
Domain Number 3 Region: 1095-1188
Classification Level Classification E-value
Superfamily Fibronectin type III 8.66e-16
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 1191-1285
Classification Level Classification E-value
Superfamily Starch-binding domain-like 9.57e-16
Family Starch-binding domain 0.005
Further Details:      
 
Domain Number 5 Region: 867-958
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000173
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 6 Region: 778-859
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000823
Family alpha-Amylases, C-terminal beta-sheet domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269839307|ref|YP_003323999.1|
Sequence length 1307
Comment alpha amylase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MRRYRLYVCLVVVMLLMGFLRSSPAAASHVPFSTATVAGSFQSEIGCPGDWQPSCDLSLM
SDPDGDGVYTFTIPAGTLPVGAYEYKVALNRSWDYSFPANNQRFEVAAADNSVTFYYNSA
THEVRHVVEGTRPPRIGDDDVFWDGLRHDSRDTLYRVPFGAVPEGAEFLVRFRTFHDDVS
SVTVRVWHTGLNAERLYDMQRVAQDVSCYQDLPFNCDFWQARIEAGPIGTIYYRFIVRDG
SKVVYYEDDSEVRDGGMGRPFDQSPDWGWAVTVHRRDFLPITWMKNAVVYQIFPDRFRNG
DPSNDPKPVRGNPRLSSDPRYAYPNGDPTGASRPEWDQILRMRWGELPEGYCRNYAGDYP
CPQRFAQPASTREQPRGRDYYGGDLEGVTEKLSYLKRLGVTAIYFNPIFAAGSNHRYDTR
DYKIIDPYLGNLGDWRTLVRAAHRQGIRIILDGVFNHMSSDSPVFDRYHNWNDALYGVGA
CESVSSPYRSWFRFRRPVGSEPAACAPYTRDGDSYYAAWAGFDSLPQLAESDPVKAHIYG
ADSSVARYWLRQGADGWRLDVMPDKSVAFWREFRQRVKQVDPNAVIIGELWKKFDVLPFV
QGDTADTTMNYRFRDAVISLLAPGPFDGKGFPGSGQPIRPSEFVNRLQSIREDYPDATYW
TLMNLLDSHDTERVLWTLTPGVENPDGRERNSAHLAEGKTRLRLAALIQMTMPGAPTIYY
GDEVGLTGDDDPDDRRTFPWGDREARAEGDERQPDMAMYRYYRDLIHERRKHPSLVNGDL
RFLLVDDDAGVVAYGRKWRDEASIVVLNTSKQARQVTVPVVGYLPENTELSWLVGGHGEA
YVRNGGVILSLGPLAGALLVTRDADLTPTAAPSGLQASADGMQVHLSWQPVAGAVGYNVY
RSPVTGGGYVRVNAAPVTTTGYLDDSAELRSGQKYYYVVRALDGVGNESANSNEASATPG
YRIGWANLQWPHSLDYTVSARYTTDTVYGQVWIDGVTNQPGPTPGLIAQLGYGPQGSDPR
SWDTWVPMQFNTDVGNNDEYKGVLQPDTPGTYDYLVRYSTTGGESWTYGDIDGTESGSFQ
DQVDSPGTLVVHPNPDQTPPEAPTNLRAYNNGPSSILLDWDASTSLDVYRYDVYRSTQPG
GPYDRVGSTDAAITQYADSGLQTGTRYYYVVRAVDEAANVSAPSNEASAVPSSRQVAVTF
EVAVPATTPPDATVYIVGNQPQICNWCNPHTVALTKGDDGKWRITLEFTEGTSVEYKYTL
GSWDYVEKGPSCEEISNRTLRVVGDSEGRQLVQDTVANWRNISPCGN
Download sequence
Identical sequences D1CHF6
gi|269839307|ref|YP_003323999.1| WP_012876208.1.85100 525904.Tter_2278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]