SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839333|ref|YP_003324025.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839333|ref|YP_003324025.1|
Domain Number 1 Region: 63-339
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.28e-77
Family L-arabinose binding protein-like 0.0000122
Further Details:      
 
Domain Number 2 Region: 3-61
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.26e-17
Family GalR/LacI-like bacterial regulator 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269839333|ref|YP_003324025.1|
Sequence length 347
Comment LacI family transcriptional regulator [Thermobaculum terrenum ATCC BAA-798]
Sequence
MGNVKISDVAKKAGVSTATVSRVLSGKTTVDPILRDRVLKAVEETGYKPDRVARSLRKRQ
SSIIGLIISDIQNPFFISLVRAVEDVAQKHGYIVMLGNADEDERKEREYIQVMISERVAG
VIVSPSREYNDPCEDLVRAKIPLVLVDRRVPGLDVDTIVVNNTWAAQQLVMHLIEHGHSR
IGAVLGTSIVATGRERREGYVQALLQYGFPIIPNLIKVGPPPPSGANREDTGYRLTMELL
NAKERPTALFTGTNLLTIGALRAIQEKGLSIPEDIALVGFDDIDWMPVYNPSITVAAQPT
YHIGRIAAEMLIARIQGDESPAQEIVLQPEIKIRRSCGQHVSINCDK
Download sequence
Identical sequences D1CHI2
gi|269839333|ref|YP_003324025.1| WP_012876234.1.85100 525904.Tter_2304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]