SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269839537|ref|YP_003324229.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839537|ref|YP_003324229.1|
Domain Number 1 Region: 115-371
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.32e-76
Family D-glucarate dehydratase-like 0.00014
Further Details:      
 
Domain Number 2 Region: 1-131
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.57e-30
Family Enolase N-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269839537|ref|YP_003324229.1|
Sequence length 372
Comment mandelate racemase/muconate lactonizing protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MRITDVEAIYLRLPEVDPSRADGTQDTLLVRVHTDEGITGVGEVDSSPLVARAAIEAPVS
HSVAMGLKHVLLGENPLEIDRLWERMYRATIYFGRGGPAMHAMSGIDLALWDILGKATGL
SVSELLGGARRHRLRAYASAIMPETPVEAGRLAEQYAAAGYTAVKFGWGPIGRSRRLDEE
LVQAIRSAVGEDVDVMIDAGMAWDLKGALRMAEVYERYGVYWLEEPLAPDDLEGYRQLAD
RTRMYIAAGEQESGAEAFRRLINEGHVDVVQPDLGRCGGLTEGRRIAQVVHARHRQLVPH
AFKSGILVAASAHLAACIPGGAMIEYTVSTSPIARDLVSEPLELVDGHVLLPERPGLGVE
VDESVVQRYRVA
Download sequence
Identical sequences D1CI36
WP_012876438.1.85100 gi|269839537|ref|YP_003324229.1| 525904.Tter_2518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]