SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269839693|ref|YP_003324385.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839693|ref|YP_003324385.1|
Domain Number 1 Region: 363-541
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.4e-41
Family Pyruvate oxidase and decarboxylase PP module 0.0018
Further Details:      
 
Domain Number 2 Region: 3-180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.27e-39
Family Pyruvate oxidase and decarboxylase Pyr module 0.00086
Further Details:      
 
Domain Number 3 Region: 151-338
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 9.35e-34
Family Pyruvate oxidase and decarboxylase, middle domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269839693|ref|YP_003324385.1|
Sequence length 550
Comment thiamine pyrophosphate protein central region [Thermobaculum terrenum ATCC BAA-798]
Sequence
MERKIYDAVAETLTYLGVKVFFGLIGSGNFHVSNALCEWGAQFIPARHEGGAITMADAWA
RLTGLVGVCTVHQGPGLTNTMTGLTEAVKSRTPLLLLAADTAGAAVHSNFKIDQEGLVRS
VGAIAERVHGPATVVEDTVRAWWRAQVERRPVVLMLPLDVQSAPFEGKVSIPPIAPIYPA
RPSGEAVTRTLYALEAAQRPLIIAGRGAVISGARDALEALGEQVGALMATSAAANGLFAG
NPWYVGISGGFASPAAAELIASADLVLAFGASLNMWTTRHGKLINPGATVVQVDHEPQAL
GYHHRVDIAVLGDARQTALELLRELLGHDISRQGWRTDEVARKLAEGCWQRAPYEDRSSE
LQIDPRTLSRALDEMLPEEKVLVTDSGHFMGYPAMYIRVPDAQGFVFTQAYQSVGLGLAT
AIGAAIARPDRLTVAALGDGGALMGLSELETVARLGLHMLIVIYNDSAYGAEVHHFGPEG
APLDIVRFPDFDFAPLAEAVGIRGVTVRKLEDLEAVGQWLEAEAEGAMLVDAKVVPDVVA
EWLEEAFRGH
Download sequence
Identical sequences D1CIJ2
gi|269839693|ref|YP_003324385.1| WP_012876594.1.85100 525904.Tter_2675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]