SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269839698|ref|YP_003324390.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839698|ref|YP_003324390.1|
Domain Number 1 Region: 32-180
Classification Level Classification E-value
Superfamily PR-1-like 0.00000000000000484
Family PR-1-like 0.0082
Further Details:      
 
Weak hits

Sequence:  gi|269839698|ref|YP_003324390.1|
Domain Number - Region: 308-414
Classification Level Classification E-value
Superfamily E set domains 0.0329
Family Copper resistance protein C (CopC, PcoC) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269839698|ref|YP_003324390.1|
Sequence length 417
Comment hypothetical protein Tter_2680 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MINRVYLCLSLCLALLALLAPRAALAGVSIADEQARAVSEVNRYRQSVGLPAVTATTALN
TAARKHAVYMLETGEMDHYETQKNSPYYVAYSPYGRARLFGYSNSSISENIRWSSEGAVG
TRTYVGVDNAVQWWMAAIYHRFAIISPRTENIGYGVYYKAGESAQVMDFGTDYSRTGPMV
RWPRPNQRGVGTYLNGESPNPVAQFGGDFPTGYPVSITWYRGTVRYTSIQMVRVSDGKAI
PGYRLSPQNDDFHRWSTSLSFIPKDPLDHSTTYRVTFRGFYSPTGSTSDERSFSYTWSFT
TQPPQGNLRSSSPANGSTGVALTPTIKLYFERGLRSYTLVPNSAVGSYWQAVGLGLRRSD
GTNVAIDVVEPTDPYTTSVSLRPVNALSPNTWYTLYYQVYDRWGRPVRGQVRFTTGR
Download sequence
Identical sequences D1CIJ7
gi|269839698|ref|YP_003324390.1| 525904.Tter_2680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]