SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925164|ref|YP_003321787.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925164|ref|YP_003321787.1|
Domain Number 1 Region: 729-864
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 5.89e-29
Family L,D-transpeptidase catalytic domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 487-590
Classification Level Classification E-value
Superfamily L,D-transpeptidase pre-catalytic domain-like 0.0000144
Family L,D-transpeptidase pre-catalytic domain-like 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|269925164|ref|YP_003321787.1|
Domain Number - Region: 359-466
Classification Level Classification E-value
Superfamily L,D-transpeptidase pre-catalytic domain-like 0.0017
Family L,D-transpeptidase pre-catalytic domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269925164|ref|YP_003321787.1|
Sequence length 866
Comment ErfK/YbiS/YcfS/YnhG family protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
METGQVRTLPSAFGLAKLSWNRNRLLLAGMLAFILLLLAASGIYAIAYSGKIYPGVKVLG
VDLSGKTKQEAARLLQSRADKLLESPVVLTADKHRFQVKSSDLGVRFDIQAMVDSAYQFG
RSDAFASRWLQRFMAPFSDHEVAPVVSLNNAKTRDTLESIASTVDRPVRNAKIILGEDGP
RFITSQVGVKLDIDSNLKSLSNSIPRAYEKSTTVSLKVIYTRPSIEDSDLQPIYKGLVAA
WNRPLTLKFGDKQWAMPVSEVRQLLRLDTSGKLPKPYLLEAPIRNWLEDISQEIDSDPVD
ARIKVLSQSVELVPHKDGYTLLEDQTVERIQTEAFKSGIIDVVVQVTHPNLTTESLKPVV
DKANAMVNQPFEVSYRNRSWTLEPQDLVQMLRWNKDDTPPTPYISRNKLRTWLSGVAERI
ERSPVNARVIVDNGKVRIIPARIGVRLDIDANLKALISAISSGNTRQFALQVQRWEPKIR
SSDLRPAVDLANQLISDPITVSYSSGNWNIDSTTLASWLRWEGNGKDITPVLDYDSVRSF
VYQIAQQVNKDPSDAYLSVAGGYAHIVPETVGVTVDIESTTQKIINAASTSTRNVTLDVT
TSYPQVTSDDLKPALDKMLYWTGERFYMSLNGRTWWLDPSDLVLALRWYGTGENTVVYLD
ENALEQQIRRWVPQDSVTDMDINYSATAQVAMKAIVNGNRHIAIVAEPIKNDTSDQEHKG
YESFWKGDFPDKWIDINLSSQSLAAYEGSKQVKVSLITSGRPELPTPTGLFHVLSKISPK
VFISPWPKDSEWYYPPSKANFALLFRSGGYYIHDAPWRSVYGPGTNGSGPPGDARTGSHG
CVNVPYSMMAWLYSWAEVGTPVLIHY
Download sequence
Identical sequences D1CDF9
WP_012874000.1.85100 gi|269925164|ref|YP_003321787.1| 525904.Tter_0042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]