SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269925171|ref|YP_003321794.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925171|ref|YP_003321794.1|
Domain Number 1 Region: 116-584
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.9e-143
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000822
Further Details:      
 
Domain Number 2 Region: 23-108
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.000000144
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269925171|ref|YP_003321794.1|
Sequence length 811
Comment ribonucleoside-diphosphate reductase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSGTTYIDTSSIHTIEDLEREVQALIDSGRATKLEGYREKIFLDRYARKDPNGTPLEHYP
EEMWLRVAKAIAAVEPNPEAQRQWTLRFYDILQGFRFVPGGRILSGAGSGAEVTYYNCFV
IPSPEDSVEGIFRNITTAAHIMRRSGGVGVNLSSLRPRGAYIKTVNGTSSGPCSWAILYS
DMTGKVIIQGGSRRGALMIMLDDDHPDIEEFVEYKRKNPGHIDHANLSVAVSDAFMEAVK
KDLPWDLKWQGKVWKTIRARDLWRKIAESAWAYAEPGLVFIDRYNKRSNTWYFENIRCVN
PCGEQGLPPWGVCNLGALNLLAFVKHIDGETYFDFEDLANTARVAIRFLDNVIDATVYPF
PENEEAQKHGARRTGLGTMGLADVLIKLGVKYGSPEAEPLVERIYRTIRDAAYDASADLA
AEKGPFPKFDRDKYMQGEFIRELPEEIQAKIRRQGIRNAVLLTQAPTGTTSSLAGVNSGI
EPVFAFVTKRRDRLGEHLLYHPLAQEWMDAHPGKPLPDYFVSSADLTPEEHIRIQAVVQK
YTDSSISKTVNGPEDNTVEDVERLYMLAYDTGCKGITYYRQGSRDAVLEAVDTKPKEKAE
KPEEAPKASHPEVHRSTLKKRPDVVSGYTRQIRAPEGKVNITLNSDDEGLLEVFINLGKA
GSDIAAMAEALGRLISFALQMPSPMSPNERAAEIADQLRGIGGSRSVGFGPGQVKSLPDA
VGQALLKHLQSEGIALSNGNGNGHADVESKELVAVVAQNGNHGEETPESIAQKLLEKTYQ
LTGNLCPSCGCNSLIAQEGCKKCYTCGYSEC
Download sequence
Identical sequences D1CDG6
WP_012874007.1.85100 gi|269925171|ref|YP_003321794.1| 525904.Tter_0049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]